Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries) |
Domain d4neke_: 4nek E: [229341] automated match to d2ej5a_ complexed with peg |
PDB Entry: 4nek (more details), 2.3 Å
SCOPe Domain Sequences for d4neke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4neke_ c.14.1.0 (E:) automated matches {Magnetospirillum magneticum [TaxId: 342108]} selvlshveggvqvvrmnrpdkknaligemyaalaeafakgeadddvnvflilgsqtdfs agndlpdfltwealsgsvadrfiravagarkpvvaavrgaaigigstllphcdlvyaapg trfhmpfinlgivpeagssqtmpalaghrraaemlmlgepfgvdtaeavglingvvpged leetamaaarklaakprsilvqikalmktpaepimdrltreaavfdtclkgealneavsa fkekrapdfsk
Timeline for d4neke_: