![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.32: GLA-domain [57629] (1 superfamily) Calcium ion-bound |
![]() | Superfamily g.32.1: GLA-domain [57630] (2 families) ![]() gamma-carboxy-glutamic acid-rich domain |
![]() | Family g.32.1.1: GLA-domain [57631] (7 proteins) |
![]() | Protein automated matches [229333] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [229334] (1 PDB entry) |
![]() | Domain d4mzza_: 4mzz A: [229335] automated match to d1q3ma_ |
PDB Entry: 4mzz (more details), 1.88 Å
SCOPe Domain Sequences for d4mzza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mzza_ g.32.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} epkrevcelnpdcdeladhigfqeayrrfyg
Timeline for d4mzza_: