Lineage for d4mzza_ (4mzz A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462844Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 1462845Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 1462846Family g.32.1.1: GLA-domain [57631] (7 proteins)
  6. 1462905Protein automated matches [229333] (1 species)
    not a true protein
  7. 1462906Species Bos taurus [TaxId:9913] [229334] (1 PDB entry)
  8. 1462907Domain d4mzza_: 4mzz A: [229335]
    automated match to d1q3ma_

Details for d4mzza_

PDB Entry: 4mzz (more details), 1.88 Å

PDB Description: Crystal structure of Bovine 3 Glu-Osteocalcin.
PDB Compounds: (A:) Osteocalcin

SCOPe Domain Sequences for d4mzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzza_ g.32.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
epkrevcelnpdcdeladhigfqeayrrfyg

SCOPe Domain Coordinates for d4mzza_:

Click to download the PDB-style file with coordinates for d4mzza_.
(The format of our PDB-style files is described here.)

Timeline for d4mzza_:

1462907
d4mzza_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4mzzb_