Lineage for d4mb1a1 (4mb1 A:3-482)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339758Protein automated matches [190099] (14 species)
    not a true protein
  7. 1339763Species Bacillus subtilis [TaxId:224308] [228099] (4 PDB entries)
  8. 1339765Domain d4mb1a1: 4mb1 A:3-482 [229325]
    Other proteins in same PDB: d4mb1a2
    automated match to d1uoka2
    complexed with ca, trs; mutant

Details for d4mb1a1

PDB Entry: 4mb1 (more details), 1.4 Å

PDB Description: The Structure of MalL mutant enzyme G202P from Bacillus subtilus
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4mb1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mb1a1 c.1.8.1 (A:3-482) automated matches {Bacillus subtilis [TaxId: 224308]}
ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
dvmrfwmdrgvdgwrmdvipsiskytdfpdyetdhsrsyivgryhsngprlhefiqemnr
evlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpf
dlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmk
gtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhar
tpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiy

SCOPe Domain Coordinates for d4mb1a1:

Click to download the PDB-style file with coordinates for d4mb1a1.
(The format of our PDB-style files is described here.)

Timeline for d4mb1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mb1a2