SCOPe 2.04: Domain d4l9sa_: 4l9s A:

Lineage for d4l9sa_ (4l9s A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (104 PDB entries)
   Uniprot Q6P716

8. Domain d4l9sa_: 4l9s A: [229311]
   automated match to d3sfva_
   complexed with ca, gdp, mg, na

Details for d4l9sa_

PDB Entry: 4l9s, 1.61 Å

PDB Description: crystal structure of h-ras g12c, gdp-bound

PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d4l9sa_:

Sequence, based on SEQRES records:

>d4l9sa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d4l9sa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
rdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartves
rqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d4l9sa_:

• d4l9sa_ first appeared in SCOPe 2.03
  
• d4l9sa_ appears in SCOPe 2.05
  
• d4l9sa_ appears in the current release, SCOPe 2.08