SCOPe 2.07: Domain d4kh0d1: 4kh0 D:2-100

Lineage for d4kh0d1 (4kh0 D:2-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d4kh0d1: 4kh0 D:2-100 [229298]
   Other proteins in same PDB: d4kh0a1, d4kh0a2, d4kh0b2, d4kh0c1, d4kh0c2, d4kh0d2
   automated match to d2fzcb1
   complexed with atp, mg, pal, zn

Details for d4kh0d1

PDB Entry: 4kh0, 2.25 Å

PDB Description: the r state structure of e. coli atcase with atp and magnesium bound

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kh0d1:

Sequence; same for both SEQRES and ATOM records:

>d4kh0d1 d.58.2.1 (D:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d4kh0d1:

• d4kh0d1 first appeared in SCOPe 2.03
  
• d4kh0d1 appears in SCOPe 2.06
  
• d4kh0d1 appears in the current release, SCOPe 2.08