Lineage for d4jaca_ (4jac A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978660Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries)
  8. 1978673Domain d4jaca_: 4jac A: [229253]
    automated match to d3lb2a_
    complexed with azi, hem, so4

Details for d4jaca_

PDB Entry: 4jac (more details), 1.93 Å

PDB Description: Dehaloperoxidase-Hemoglobin T56S
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4jaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaca_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d4jaca_:

Click to download the PDB-style file with coordinates for d4jaca_.
(The format of our PDB-style files is described here.)

Timeline for d4jaca_: