Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries) |
Domain d4bksk_: 4bks K: [229195] Other proteins in same PDB: d4bksa_, d4bksc_, d4bksd_, d4bksf_, d4bksg_, d4bksi_, d4bksj_, d4bksl_ automated match to d4awjk_ complexed with act, x6c |
PDB Entry: 4bks (more details), 2.2 Å
SCOPe Domain Sequences for d4bksk_:
Sequence, based on SEQRES records: (download)
>d4bksk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm yftykvrytnssteipefpiapeialellmaanfldc
>d4bksk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} mmyvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytns steipefpiapeialellmaanfldc
Timeline for d4bksk_: