Lineage for d3zbta1 (3zbt A:9-141)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792139Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1792176Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 1792281Protein automated matches [227029] (5 species)
    not a true protein
  7. 1792295Species Nostoc sp. [TaxId:1168] [229175] (3 PDB entries)
  8. 1792297Domain d3zbta1: 3zbt A:9-141 [229176]
    Other proteins in same PDB: d3zbta2
    automated match to d1quea1
    complexed with fad, gol, so4; mutant

Details for d3zbta1

PDB Entry: 3zbt (more details), 1.92 Å

PDB Description: ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zbta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zbta1 b.43.4.2 (A:9-141) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqaigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d3zbta1:

Click to download the PDB-style file with coordinates for d3zbta1.
(The format of our PDB-style files is described here.)

Timeline for d3zbta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zbta2