Lineage for d1dyza_ (1dyz A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (3 PDB entries) 
Domain d1dyza_: 1dyz A: [22917]
Details for d1dyza_
PDB Entry: 1dyz (more details), 1.75 Å
PDB Description: oxidised azurin ii from alcaligenes xylosoxidans
SCOP Domain Sequences for d1dyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyza_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs
SCOP Domain Coordinates for d1dyza_:
Click to download the PDB-style file with coordinates for d1dyza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dyza_:
- d1dyza_ appears in SCOP 1.57
- d1dyza_ appears in the current release, SCOPe 2.08
View in 3D