Lineage for d4n5zd_ (4n5z D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709681Domain d4n5zd_: 4n5z D: [229156]
    Other proteins in same PDB: d4n5za_, d4n5zc_, d4n5ze_, d4n5zg_, d4n5zi_, d4n5zk_, d4n5zm_, d4n5zo_, d4n5zq_, d4n5zs_, d4n5zu_, d4n5zw_, d4n5zy_
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d4n5zd_

PDB Entry: 4n5z (more details), 2.95 Å

PDB Description: crystal structure of aerosol transmissible influenza h5 hemagglutinin mutant (n158d, n224k, q226l and t318i) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4n5zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5zd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr

SCOPe Domain Coordinates for d4n5zd_:

Click to download the PDB-style file with coordinates for d4n5zd_.
(The format of our PDB-style files is described here.)

Timeline for d4n5zd_: