Lineage for d4jrab2 (4jra B:1080-1296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062297Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2062340Protein automated matches [229100] (4 species)
    not a true protein
  7. 2062341Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2062350Domain d4jrab2: 4jra B:1080-1296 [229102]
    Other proteins in same PDB: d4jraa1, d4jrab1
    automated match to d3btaa2
    complexed with cl, na

Details for d4jrab2

PDB Entry: 4jra (more details), 2.3 Å

PDB Description: crystal structure of the botulinum neurotoxin a receptor-binding domain in complex with the luminal domain of sv2c
PDB Compounds: (B:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d4jrab2:

Sequence, based on SEQRES records: (download)

>d4jrab2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d4jrab2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasdnivrnndrvyinvvvknkeyrlatnasqagv
ekilsaleipdvgnlsqvvvmkskndqtnkckmnlqdnngndigfigfhqfnniaklvas
nwynrqierlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d4jrab2:

Click to download the PDB-style file with coordinates for d4jrab2.
(The format of our PDB-style files is described here.)

Timeline for d4jrab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jrab1