Lineage for d1a4bb_ (1a4b B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries) 
Domain d1a4bb_: 1a4b B: [22910]
Details for d1a4bb_
PDB Entry: 1a4b (more details), 1.91 Å
PDB Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at-180 degrees celsius
SCOP Domain Sequences for d1a4bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4bb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn
SCOP Domain Coordinates for d1a4bb_:
Click to download the PDB-style file with coordinates for d1a4bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4bb_:
- d1a4bb_ appears in SCOP 1.57
- d1a4bb_ appears in the current release, SCOPe 2.08
View in 3D
