Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein automated matches [227029] (5 species) not a true protein |
Species Anabaena sp. [TaxId:1167] [229044] (3 PDB entries) |
Domain d4bpra1: 4bpr A:9-141 [229045] Other proteins in same PDB: d4bpra2 automated match to d1quea1 complexed with fad, gol, so4; mutant |
PDB Entry: 4bpr (more details), 2 Å
SCOPe Domain Sequences for d4bpra1:
Sequence, based on SEQRES records: (download)
>d4bpra1 b.43.4.2 (A:9-141) automated matches {Anabaena sp. [TaxId: 1167]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlfsiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
>d4bpra1 b.43.4.2 (A:9-141) automated matches {Anabaena sp. [TaxId: 1167]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlfsiastrhgddvddktislcvrqleykhptvygvcstylthiepgsevki tgpvgkeml
Timeline for d4bpra1: