Lineage for d4bpra1 (4bpr A:9-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793635Protein automated matches [227029] (5 species)
    not a true protein
  7. 2793638Species Anabaena sp. [TaxId:1167] [229044] (3 PDB entries)
  8. 2793641Domain d4bpra1: 4bpr A:9-141 [229045]
    Other proteins in same PDB: d4bpra2
    automated match to d1quea1
    complexed with fad, gol, so4; mutant

Details for d4bpra1

PDB Entry: 4bpr (more details), 2 Å

PDB Description: ferredoxin-nadp reductase mutant with tyr 79 replaced by phe (y79f)
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d4bpra1:

Sequence, based on SEQRES records: (download)

>d4bpra1 b.43.4.2 (A:9-141) automated matches {Anabaena sp. [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlfsiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

Sequence, based on observed residues (ATOM records): (download)

>d4bpra1 b.43.4.2 (A:9-141) automated matches {Anabaena sp. [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlfsiastrhgddvddktislcvrqleykhptvygvcstylthiepgsevki
tgpvgkeml

SCOPe Domain Coordinates for d4bpra1:

Click to download the PDB-style file with coordinates for d4bpra1.
(The format of our PDB-style files is described here.)

Timeline for d4bpra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bpra2