Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d3wjjb1: 3wjj B:238-341 [229039] Other proteins in same PDB: d3wjjc1, d3wjjc2 automated match to d1igtb3 |
PDB Entry: 3wjj (more details), 2.6 Å
SCOPe Domain Sequences for d3wjjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wjjb1 b.1.1.0 (B:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]} dsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d3wjjb1:
View in 3D Domains from other chains: (mouse over for more information) d3wjja1, d3wjja2, d3wjjc1, d3wjjc2 |