SCOPe 2.07: Domain d3wjja1: 3wjj A:233-341

Lineage for d3wjja1 (3wjj A:233-341)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3wjja1: 3wjj A:233-341 [229037]
   Other proteins in same PDB: d3wjjc1, d3wjjc2
   automated match to d1igtb3

Details for d3wjja1

PDB Entry: 3wjj, 2.6 Å

PDB Description: crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3wjja1:

Sequence; same for both SEQRES and ATOM records:

>d3wjja1 b.1.1.0 (A:233-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ellggdsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpr
eeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d3wjja1:

• d3wjja1 first appeared in SCOPe 2.03
  
• d3wjja1 appears in SCOPe 2.06
  
• d3wjja1 appears in the current release, SCOPe 2.08