SCOPe 2.03: Domain d3w8la_: 3w8l A:

Lineage for d3w8la_ (3w8l A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (34 PDB entries)

8. Domain d3w8la_: 3w8l A: [229034]
   automated match to d3at2a_
   complexed with i6p

Details for d3w8la_

PDB Entry: 3w8l, 2.4 Å

PDB Description: crystal structure of human ck2 in complex with inositol hexakisphosphate

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3w8la_:

Sequence; same for both SEQRES and ATOM records:

>d3w8la_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeavnitnne
kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytvvk

Timeline for d3w8la_:

• d3w8la_ is new in SCOPe 2.03-stable
  
• d3w8la_ appears in SCOPe 2.04
  
• d3w8la_ appears in the current release, SCOPe 2.08