SCOPe 2.03: Domain d3wjlc1: 3wjl C:3-85

Lineage for d3wjlc1 (3wjl C:3-85)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)

8. Domain d3wjlc1: 3wjl C:3-85 [229031]
   Other proteins in same PDB: d3wjla1, d3wjla2, d3wjlb1, d3wjlb2
   automated match to d2fcba1
   complexed with nag

Details for d3wjlc1

PDB Entry: 3wjl, 2.86 Å

PDB Description: crystal structure of iib selective fc variant, fc(v12), in complex with fcgriib

PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor II-c

SCOPe Domain Sequences for d3wjlc1:

Sequence, based on SEQRES records:

>d3wjlc1 b.1.1.4 (C:3-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkannnd
sgeytcqtgqtslsdpvhltvls

Sequence, based on observed residues (ATOM records):

>d3wjlc1 b.1.1.4 (C:3-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkavlklepqwinvlqedsvtltcrsiqwfhngnlipthtqpsyrfkannndsgeytcqt
gqtslsdpvhltvls

Timeline for d3wjlc1:

• d3wjlc1 is new in SCOPe 2.03-stable
  
• d3wjlc1 appears in SCOPe 2.04
  
• d3wjlc1 appears in the current release, SCOPe 2.08