Lineage for d3vz6a_ (3vz6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851353Protein automated matches [191245] (3 species)
    not a true protein
  7. 2851354Species Escherichia coli K-12 [TaxId:83333] [229025] (1 PDB entry)
  8. 2851355Domain d3vz6a_: 3vz6 A: [229026]
    automated match to d1la1a_

Details for d3vz6a_

PDB Entry: 3vz6 (more details), 1.5 Å

PDB Description: Crystal Structure Analysis of the Mini-chaperonines, variant with Gly 184 replaced with Ile and Leu 185 replaced Val and Val 186 replaced with Leu.
PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3vz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vz6a_ c.8.5.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ivltgsaegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
klqervaklaggv

SCOPe Domain Coordinates for d3vz6a_:

Click to download the PDB-style file with coordinates for d3vz6a_.
(The format of our PDB-style files is described here.)

Timeline for d3vz6a_: