Lineage for d2azaa_ (2aza A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries) 
Domain d2azaa_: 2aza A: [22901]
Details for d2azaa_
PDB Entry: 2aza (more details), 1.8 Å
PDB Description: structure of azurin from alcaligenes denitrificans. refinement at 1.8 angstroms resolution and comparison of the two crystallographically independent molecules
SCOP Domain Sequences for d2azaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azaa_ b.6.1.1 (A:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn
SCOP Domain Coordinates for d2azaa_:
Click to download the PDB-style file with coordinates for d2azaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2azaa_:
- d2azaa_ appears in SCOP 1.57
- d2azaa_ appears in the current release, SCOPe 2.08
View in 3D
