SCOPe 2.06: Domain d4m9aa2: 4m9a A:229-377

Lineage for d4m9aa2 (4m9a A:229-377)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [228981] (1 PDB entry)

8. Domain d4m9aa2: 4m9a A:229-377 [228984]
   Other proteins in same PDB: d4m9aa1, d4m9ab1, d4m9ac1, d4m9ad1
   automated match to d1ukwa1
   complexed with fda

Details for d4m9aa2

PDB Entry: 4m9a, 2.2 Å

PDB Description: Crystal structure of Acyl-coA dehydrogenase from Burkholderia thailandensis E264

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4m9aa2:

Sequence; same for both SEQRES and ATOM records:

>d4m9aa2 a.29.3.0 (A:229-377) automated matches {Burkholderia thailandensis [TaxId: 271848]}
geglkialsnleggrigiaaqatgiaraafdrarryarervqfgkpiaehqaiaeklanm
atqinaarllthhaarlrtaglpclseasqaklfasemaeavcsdaiqihggygflvdye
verhyrdaritqiyegtsevqrmviarql

Timeline for d4m9aa2:

• d4m9aa2 first appeared in SCOPe 2.03
  
• d4m9aa2 appears in SCOPe 2.05
  
• d4m9aa2 appears in SCOPe 2.07
  
• d4m9aa2 appears in the current release, SCOPe 2.08