SCOPe 2.06: Domain d4m9ac1: 4m9a C:2-228

Lineage for d4m9ac1 (4m9a C:2-228)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (25 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [228976] (1 PDB entry)

8. Domain d4m9ac1: 4m9a C:2-228 [228980]
   Other proteins in same PDB: d4m9aa2, d4m9ab2, d4m9ac2, d4m9ad2
   automated match to d1ukwa2
   complexed with fda

Details for d4m9ac1

PDB Entry: 4m9a, 2.2 Å

PDB Description: Crystal structure of Acyl-coA dehydrogenase from Burkholderia thailandensis E264

PDB Compounds: (C:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4m9ac1:

Sequence, based on SEQRES records:

>d4m9ac1 e.6.1.0 (C:2-228) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
afsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrgl
safvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkr

Sequence, based on observed residues (ATOM records):

>d4m9ac1 e.6.1.0 (C:2-228) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
afsltephahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrglsafv
vptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkr

Timeline for d4m9ac1:

• d4m9ac1 first appeared in SCOPe 2.03
  
• d4m9ac1 appears in SCOPe 2.05
  
• d4m9ac1 appears in SCOPe 2.07
  
• d4m9ac1 appears in the current release, SCOPe 2.08