Lineage for d1f56c_ (1f56 C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 56076Protein Plantacyanin [49527] (2 species)
  7. 56079Species Spinach (Spinacia oleracea) [TaxId:3562] [49529] (1 PDB entry)
  8. 56082Domain d1f56c_: 1f56 C: [22898]

Details for d1f56c_

PDB Entry: 1f56 (more details), 2.05 Å

PDB Description: spinach plantacyanin

SCOP Domain Sequences for d1f56c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f56c_ b.6.1.1 (C:) Plantacyanin {Spinach (Spinacia oleracea)}
avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
drikltrgqnyficsfpghcgggmkiainak

SCOP Domain Coordinates for d1f56c_:

Click to download the PDB-style file with coordinates for d1f56c_.
(The format of our PDB-style files is described here.)

Timeline for d1f56c_: