Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [228976] (1 PDB entry) |
Domain d4m9ab1: 4m9a B:2-228 [228979] Other proteins in same PDB: d4m9aa2, d4m9ab2, d4m9ac2, d4m9ad2 automated match to d1ukwa2 complexed with fda |
PDB Entry: 4m9a (more details), 2.2 Å
SCOPe Domain Sequences for d4m9ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m9ab1 e.6.1.0 (B:2-228) automated matches {Burkholderia thailandensis [TaxId: 271848]} ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg afsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrgl safvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkr
Timeline for d4m9ab1: