Lineage for d4m9aa1 (4m9a A:2-228)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246323Species Burkholderia thailandensis [TaxId:271848] [228976] (1 PDB entry)
  8. 2246324Domain d4m9aa1: 4m9a A:2-228 [228978]
    Other proteins in same PDB: d4m9aa2, d4m9ab2, d4m9ac2, d4m9ad2
    automated match to d1ukwa2
    complexed with fda

Details for d4m9aa1

PDB Entry: 4m9a (more details), 2.2 Å

PDB Description: Crystal structure of Acyl-coA dehydrogenase from Burkholderia thailandensis E264
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4m9aa1:

Sequence, based on SEQRES records: (download)

>d4m9aa1 e.6.1.0 (A:2-228) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
afsltephagseahnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrgl
safvvptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkr

Sequence, based on observed residues (ATOM records): (download)

>d4m9aa1 e.6.1.0 (A:2-228) automated matches {Burkholderia thailandensis [TaxId: 271848]}
ddlytedqrmildaarafcaevlapnaaqwdreshlpdevvaqmgelgflgmivpadwgg
sytdyvayalaleeiaagcascatlvsvhnsvgcgpvlnygtteqkerwlrdlasgktvg
afsltephhnlrtraelrdgkwilngskqfvtngaraglaivfamtdpdegkrglsafvv
ptdtpgfivgkpekkmgirasdtcpitlencaipqenllgkr

SCOPe Domain Coordinates for d4m9aa1:

Click to download the PDB-style file with coordinates for d4m9aa1.
(The format of our PDB-style files is described here.)

Timeline for d4m9aa1: