Lineage for d4k1xa1 (4k1x A:16-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793778Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries)
  8. 2793780Domain d4k1xa1: 4k1x A:16-113 [228949]
    Other proteins in same PDB: d4k1xa2, d4k1xb2
    automated match to d2vnha1
    complexed with fad, so4; mutant

Details for d4k1xa1

PDB Entry: 4k1x (more details), 1.7 Å

PDB Description: Ferredoxin-NADP(H) Reductase mutant with Ala 266 replaced by Tyr (A266Y) and residues 267-272 deleted.
PDB Compounds: (A:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d4k1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1xa1 b.43.4.0 (A:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde
elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv

SCOPe Domain Coordinates for d4k1xa1:

Click to download the PDB-style file with coordinates for d4k1xa1.
(The format of our PDB-style files is described here.)

Timeline for d4k1xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k1xa2