Lineage for d4ilwa_ (4ilw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789220Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2789221Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
    contains an irregular alpha+beta subdomain in the C-terminal extension
    automatically mapped to Pfam PF00965
  6. 2789236Protein TIMP-2 [50246] (2 species)
  7. 2789241Species Human (Homo sapiens) [TaxId:9606] [50247] (4 PDB entries)
  8. 2789243Domain d4ilwa_: 4ilw A: [228945]
    Other proteins in same PDB: d4ilwd_, d4ilwf_
    automated match to d1br9a_
    complexed with ca, zn

Details for d4ilwa_

PDB Entry: 4ilw (more details), 2.1 Å

PDB Description: Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-2 (TIMP-2)
PDB Compounds: (A:) metalloproteinase inhibitor 2

SCOPe Domain Sequences for d4ilwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilwa_ b.40.3.1 (A:) TIMP-2 {Human (Homo sapiens) [TaxId: 9606]}
cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
aa

SCOPe Domain Coordinates for d4ilwa_:

Click to download the PDB-style file with coordinates for d4ilwa_.
(The format of our PDB-style files is described here.)

Timeline for d4ilwa_: