Lineage for d4nc5a_ (4nc5 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326288Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1326557Protein automated matches [193245] (7 species)
    not a true protein
  7. 1326558Species Homo sapiens [TaxId:9606] [228885] (2 PDB entries)
  8. 1326560Domain d4nc5a_: 4nc5 A: [228886]
    automated match to d1vcua_
    complexed with fsi, po4

Details for d4nc5a_

PDB Entry: 4nc5 (more details), 2.51 Å

PDB Description: human sialidase 2 in complex with 2,3-difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) Sialidase-2

SCOPe Domain Sequences for d4nc5a_:

Sequence, based on SEQRES records: (download)

>d4nc5a_ b.68.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraskkaehaelivlrrgdydap
thqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtranvt
rlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayr
klhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlra
rvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthsw
qradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeei
vflmftlkqafpaeyl

Sequence, based on observed residues (ATOM records): (download)

>d4nc5a_ b.68.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraaelivlrrgdydapthqvqw
qaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvranvtrlcqvtstdhgrtw
ssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiqrpipsafc
flshdhgrtwarghfvaqdtlecqvaevetqrvvtlnarshlrarvqaqstndgldfqes
qlvkklvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppapeawsep
vllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaeyl

SCOPe Domain Coordinates for d4nc5a_:

Click to download the PDB-style file with coordinates for d4nc5a_.
(The format of our PDB-style files is described here.)

Timeline for d4nc5a_:

  • d4nc5a_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4nc5a_ appears in SCOPe 2.04
  • d4nc5a_ appears in the current release, SCOPe 2.07, called d4nc5a1