Lineage for d4naxa1 (4nax A:3-103)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880225Species Pseudomonas putida [TaxId:351746] [228879] (1 PDB entry)
  8. 2880226Domain d4naxa1: 4nax A:3-103 [228880]
    Other proteins in same PDB: d4naxa2, d4naxa3, d4naxb2
    automated match to d4ikha1
    complexed with fmt, gds, gol

Details for d4naxa1

PDB Entry: 4nax (more details), 1.3 Å

PDB Description: crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit
PDB Compounds: (A:) Glutathione S-transferase, N-terminal domain protein

SCOPe Domain Sequences for d4naxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4naxa1 c.47.1.0 (A:3-103) automated matches {Pseudomonas putida [TaxId: 351746]}
elsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlspef
islsannkipaildpngpggqplplfesgailqylaeksgq

SCOPe Domain Coordinates for d4naxa1:

Click to download the PDB-style file with coordinates for d4naxa1.
(The format of our PDB-style files is described here.)

Timeline for d4naxa1: