Lineage for d1pza__ (1pza -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Pseudoazurin [49522] (4 species) 
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries) 
Domain d1pza__: 1pza - [22884]
Details for d1pza__
PDB Entry: 1pza (more details), 1.8 Å
PDB Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
SCOP Domain Sequences for d1pza__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pza__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
SCOP Domain Coordinates for d1pza__:
Click to download the PDB-style file with coordinates for d1pza__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pza__:
- d1pza__ appears in SCOP 1.57
- d1pza__ appears in the current release, SCOPe 2.08, called d1pzaa_
View in 3D