Lineage for d4mpka1 (4mpk A:1-240,A:309-362)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340883Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 1340884Species Buffalo (Bubalus bubalis) [TaxId:89462] [110353] (6 PDB entries)
    Uniprot Q7YS85
  8. 1340889Domain d4mpka1: 4mpk A:1-240,A:309-362 [228812]
    Other proteins in same PDB: d4mpka2
    automated match to d2o9oa1
    complexed with gol, nag

Details for d4mpka1

PDB Entry: 4mpk (more details), 2.65 Å

PDB Description: crystal structure of the complex of buffalo signaling protein spb-40 with n-acetylglucosamine at 2.65 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d4mpka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpka1 c.1.8.5 (A:1-240,A:309-362) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfX
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv

SCOPe Domain Coordinates for d4mpka1:

Click to download the PDB-style file with coordinates for d4mpka1.
(The format of our PDB-style files is described here.)

Timeline for d4mpka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mpka2