Lineage for d4ipza_ (4ipz A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325683Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1325684Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1325685Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1325686Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1325701Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (58 PDB entries)
    Uniprot P05092
  8. 1325729Domain d4ipza_: 4ipz A: [228772]
    automated match to d1w8ma_
    complexed with cl

Details for d4ipza_

PDB Entry: 4ipz (more details), 1.67 Å

PDB Description: smbz bound to cyclophilin a
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d4ipza_:

Sequence, based on SEQRES records: (download)

>d4ipza_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Sequence, based on observed residues (ATOM records): (download)

>d4ipza_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygkfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d4ipza_:

Click to download the PDB-style file with coordinates for d4ipza_.
(The format of our PDB-style files is described here.)

Timeline for d4ipza_: