Lineage for d3wbga_ (3wbg A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324891Protein automated matches [190295] (5 species)
    not a true protein
  7. 1324907Species Human (Homo sapiens) [TaxId:9606] [187133] (21 PDB entries)
  8. 1324933Domain d3wbga_: 3wbg A: [228744]
    automated match to d1lida_
    complexed with 2an

Details for d3wbga_

PDB Entry: 3wbg (more details), 2.15 Å

PDB Description: structure of the human heart fatty acid-binding protein in complex with 1-anilinonaphtalene-8-sulphonic acid
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d3wbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wbga_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyeke

SCOPe Domain Coordinates for d3wbga_:

Click to download the PDB-style file with coordinates for d3wbga_.
(The format of our PDB-style files is described here.)

Timeline for d3wbga_: