SCOPe 2.08: Domain d3w9va_: 3w9v A:

Lineage for d3w9va_ (3w9v A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Unidentified prokaryotic [TaxId:2725] [228734] (3 PDB entries)

8. Domain d3w9va_: 3w9v A: [228737]
   automated match to d2v3qa1
   complexed with gol, po4

Details for d3w9va_

PDB Entry: 3w9v, 1.03 Å

PDB Description: crystal structure of refolded ding protein

PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d3w9va_:

Sequence; same for both SEQRES and ATOM records:

>d3w9va_ c.94.1.1 (A:) automated matches {Unidentified prokaryotic [TaxId: 2725]}
dingggatlpqklyltpdvltagfapyigvgsgkgkiaflenkynqfgtdttknvhwags
dskltatelatyaadkepgwgkliqvpsvatsvaipfrkaganavdlsvkelcgvfsgri
adwsgitgagrsgpiqvvyraessgttelftrflnakcttepgtfavtttfansyslglt
plagavaatgsdgvmaalndttvaegritymspdfaaptlaglddatkvarvgkgvvngv
avegkspaaanvsaaisvvplpaaadrgnpdvwvpvfgattgggvvaypdsgypilgftn
lifsqcyanatqtgqvrdfftkhygtsanndaaieanafvplpsnwkaavrasfltasna
lsigntnvcngkgrpq

Timeline for d3w9va_:

• d3w9va_ first appeared in SCOPe 2.03
  
• d3w9va_ appears in SCOPe 2.07