SCOPe 2.04: Domain d4n5fa2: 4n5f A:229-377

Lineage for d4n5fa2 (4n5f A:229-377)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (18 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [228726] (1 PDB entry)

8. Domain d4n5fa2: 4n5f A:229-377 [228729]
   Other proteins in same PDB: d4n5fa1, d4n5fb1
   automated match to d1ukwa1
   complexed with fda, unx

Details for d4n5fa2

PDB Entry: 4n5f, 2.2 Å

PDB Description: Crystal Structure of a Putative acyl-CoA dehydrogenase with bound FADH2 from Burkholderia cenocepacia J2315

PDB Compounds: (A:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4n5fa2:

Sequence; same for both SEQRES and ATOM records:

>d4n5fa2 a.29.3.0 (A:229-377) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
geglkialsnleggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladm
avqinaarllvhhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdye
verhyrdaritqiyegtsevqrmviarql

Timeline for d4n5fa2:

• d4n5fa2 first appeared in SCOPe 2.03
  
• d4n5fa2 appears in SCOPe 2.05
  
• d4n5fa2 appears in the current release, SCOPe 2.08