Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [228726] (1 PDB entry) |
Domain d4n5fa2: 4n5f A:229-377 [228729] Other proteins in same PDB: d4n5fa1, d4n5fb1 automated match to d1ukwa1 complexed with fda, unx |
PDB Entry: 4n5f (more details), 2.2 Å
SCOPe Domain Sequences for d4n5fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5fa2 a.29.3.0 (A:229-377) automated matches {Burkholderia cenocepacia [TaxId: 216591]} geglkialsnleggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladm avqinaarllvhhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdye verhyrdaritqiyegtsevqrmviarql
Timeline for d4n5fa2: