Lineage for d1i0ya_ (1i0y A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106803Protein Plastocyanin [49507] (14 species)
  7. 106811Species Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId:1148] [49519] (5 PDB entries)
  8. 106814Domain d1i0ya_: 1i0y A: [22872]

Details for d1i0ya_

PDB Entry: 1i0y (more details)

PDB Description: solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure

SCOP Domain Sequences for d1i0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ya_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
lafaagesftstftepgtytyycephrgagmvgkvvvd

SCOP Domain Coordinates for d1i0ya_:

Click to download the PDB-style file with coordinates for d1i0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1i0ya_: