Lineage for d4lpba_ (4lpb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213721Species Streptococcus pneumoniae [TaxId:760835] [226426] (7 PDB entries)
  8. 2213725Domain d4lpba_: 4lpb A: [228705]
    automated match to d4em7a_
    complexed with 1yp

Details for d4lpba_

PDB Entry: 4lpb (more details), 1.75 Å

PDB Description: Crystal structure of a topoisomerase ATPase inhibitor
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d4lpba_:

Sequence, based on SEQRES records: (download)

>d4lpba_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
lnesafllknvtlsltdkrtdeaiefhyen

Sequence, based on observed residues (ATOM records): (download)

>d4lpba_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhavgssvvnalsswleveitrdgavykqrfengg
kpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltd
krtdeaiefhyen

SCOPe Domain Coordinates for d4lpba_:

Click to download the PDB-style file with coordinates for d4lpba_.
(The format of our PDB-style files is described here.)

Timeline for d4lpba_: