![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (3 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [228697] (4 PDB entries) |
![]() | Domain d4lnka1: 4lnk A:2-104 [228699] Other proteins in same PDB: d4lnka2, d4lnkb2, d4lnkc2, d4lnkd2, d4lnke2, d4lnkf2 automated match to d1f52a1 complexed with adp, glu, mg, so4 |
PDB Entry: 4lnk (more details), 2.87 Å
SCOPe Domain Sequences for d4lnka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnka1 d.15.9.0 (A:2-104) automated matches {Bacillus subtilis [TaxId: 1423]} akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnka1: