SCOPe 2.04: Domain d4lbec_: 4lbe C:

Lineage for d4lbec_ (4lbe C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)

8. Domain d4lbec_: 4lbe C: [228666]
   Other proteins in same PDB: d4lbea1, d4lbea2, d4lbeb1, d4lbeb2
   automated match to d1s5hc_
   complexed with dga, f09, k; mutant

Details for d4lbec_

PDB Entry: 4lbe, 2.75 Å

PDB Description: structure of kcsa with r122a mutation

PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d4lbec_:

Sequence; same for both SEQRES and ATOM records:

>d4lbec_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqeragh

Timeline for d4lbec_:

• d4lbec_ first appeared in SCOPe 2.03
  
• d4lbec_ appears in SCOPe 2.05
  
• d4lbec_ appears in the current release, SCOPe 2.08