Lineage for d4lbec_ (4lbe C:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456036Protein Potassium channel protein [56901] (2 species)
  7. 1456037Species Streptomyces coelicolor [TaxId:1902] [56902] (20 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1456049Domain d4lbec_: 4lbe C: [228666]
    Other proteins in same PDB: d4lbea1, d4lbea2, d4lbeb1, d4lbeb2
    automated match to d1s5hc_
    complexed with dga, f09, k; mutant

Details for d4lbec_

PDB Entry: 4lbe (more details), 2.75 Å

PDB Description: structure of kcsa with r122a mutation
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d4lbec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbec_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqeragh

SCOPe Domain Coordinates for d4lbec_:

Click to download the PDB-style file with coordinates for d4lbec_.
(The format of our PDB-style files is described here.)

Timeline for d4lbec_: