![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (3 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
![]() | Domain d4lbec_: 4lbe C: [228666] Other proteins in same PDB: d4lbea1, d4lbea2, d4lbea3, d4lbeb1, d4lbeb2 automated match to d1s5hc_ complexed with dga, f09, k; mutant |
PDB Entry: 4lbe (more details), 2.75 Å
SCOPe Domain Sequences for d4lbec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbec_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqeragh
Timeline for d4lbec_: