Lineage for d4hm5a2 (4hm5 A:155-446)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215017Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2215049Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. 2215067Species Pseudomonas sp. [TaxId:69011] [228600] (14 PDB entries)
  8. 2215077Domain d4hm5a2: 4hm5 A:155-446 [228613]
    Other proteins in same PDB: d4hm5a1, d4hm5b_
    automated match to d1o7na2
    complexed with 16n, edo, fe, fes, so4

Details for d4hm5a2

PDB Entry: 4hm5 (more details), 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to indene
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm5a2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 69011]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

SCOPe Domain Coordinates for d4hm5a2:

Click to download the PDB-style file with coordinates for d4hm5a2.
(The format of our PDB-style files is described here.)

Timeline for d4hm5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hm5a1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hm5b_