Lineage for d4hm2a1 (4hm2 A:1-154)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535773Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1535805Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. 1535823Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries)
  8. 1535834Domain d4hm2a1: 4hm2 A:1-154 [228608]
    Other proteins in same PDB: d4hm2a2, d4hm2b_
    automated match to d1o7na1
    complexed with 16m, edo, fe, fes, so4

Details for d4hm2a1

PDB Entry: 4hm2 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm2a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d4hm2a1:

Click to download the PDB-style file with coordinates for d4hm2a1.
(The format of our PDB-style files is described here.)

Timeline for d4hm2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hm2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4hm2b_