SCOP 1.61: Domain d1byob_: 1byo B:

Lineage for d1byob_ (1byo B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Plastocyanin [49507] (14 species)

7. Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries)

8. Domain d1byob_: 1byo B: [22860]

Details for d1byob_

PDB Entry: 1byo, 2 Å

PDB Description: wild-type plastocyanin from silene

SCOP Domain Sequences for d1byob_:

Sequence; same for both SEQRES and ATOM records:

>d1byob_ b.6.1.1 (B:) Plastocyanin {White campion (Silene pratensis)}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdedevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn

Timeline for d1byob_:

• d1byob_ first appeared (with stable ids) in SCOP 1.55
  
• d1byob_ appears in SCOP 1.59
  
• d1byob_ appears in SCOP 1.63
  
• d1byob_ appears in the current release, SCOPe 2.08