Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species) |
Species Pseudomonas sp. [TaxId:69011] [228596] (10 PDB entries) |
Domain d4hm4b_: 4hm4 B: [228598] Other proteins in same PDB: d4hm4a1, d4hm4a2 automated match to d1o7nb_ complexed with 16n, edo, fe, fes, so4 |
PDB Entry: 4hm4 (more details), 1.5 Å
SCOPe Domain Sequences for d4hm4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hm4b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 69011]} iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype rilqthnlmvfl
Timeline for d4hm4b_: