SCOPe 2.03: Domain d4h42u_: 4h42 U:

Lineage for d4h42u_ (4h42 U:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries)

8. Domain d4h42u_: 4h42 U: [228593]
   automated match to d2wpis_
   complexed with 11e, pg6

Details for d4h42u_

PDB Entry: 4h42, 2.01 Å

PDB Description: Synthesis of a Weak Basic uPA Inhibitor and Crystal Structure of Complex with uPA

PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4h42u_:

Sequence; same for both SEQRES and ATOM records:

>d4h42u_ b.47.1.2 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtkee

Timeline for d4h42u_:

• d4h42u_ is new in SCOPe 2.03-stable
  
• d4h42u_ appears in SCOPe 2.04
  
• d4h42u_ appears in the current release, SCOPe 2.08