Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (11 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [226506] (4 PDB entries) |
Domain d4hcda2: 4hcd A:127-382 [228590] Other proteins in same PDB: d4hcda1 automated match to d4hcha2 complexed with cl, mg, na |
PDB Entry: 4hcd (more details), 1.7 Å
SCOPe Domain Sequences for d4hcda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hcda2 c.1.11.2 (A:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg lgedidftfidnnrvr
Timeline for d4hcda2: