![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries) |
![]() | Domain d1byoa_: 1byo A: [22859] complexed with cu |
PDB Entry: 1byo (more details), 2 Å
SCOPe Domain Sequences for d1byoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byoa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdedevpagvdvtkismpee dllnapgeeysvtltekgtykfycaphagagmvgkvtvn
Timeline for d1byoa_: