Lineage for d4cc4d_ (4cc4 D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310427Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1310428Protein automated matches [190457] (7 species)
    not a true protein
  7. 1310459Species Human (Homo sapiens) [TaxId:9606] [187598] (23 PDB entries)
  8. 1310513Domain d4cc4d_: 4cc4 D: [228584]
    Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4c1, d4cc4c2, d4cc4e1, d4cc4e2
    automated match to d2xmfa_
    complexed with cl, gol, pe4, po4, so4

Details for d4cc4d_

PDB Entry: 4cc4 (more details), 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
PDB Compounds: (D:) Dynamin-binding protein

SCOPe Domain Sequences for d4cc4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cc4d_ b.34.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkt
eyt

SCOPe Domain Coordinates for d4cc4d_:

Click to download the PDB-style file with coordinates for d4cc4d_.
(The format of our PDB-style files is described here.)

Timeline for d4cc4d_: