SCOPe 2.08: Domain d4cc4d1: 4cc4 D:1515-1577

Lineage for d4cc4d1 (4cc4 D:1515-1577)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d4cc4d1: 4cc4 D:1515-1577 [228584]
   Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4a3, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4d2, d4cc4e1, d4cc4e2, d4cc4f2, d4cc4f3
   automated match to d2xmfa_
   complexed with cl, gol, pe4, po4, so4

Details for d4cc4d1

PDB Entry: 4cc4, 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain

PDB Compounds: (D:) Dynamin-binding protein

SCOPe Domain Sequences for d4cc4d1:

Sequence; same for both SEQRES and ATOM records:

>d4cc4d1 b.34.2.0 (D:1515-1577) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkt
eyt

Timeline for d4cc4d1:

• d4cc4d1 first appeared in SCOPe 2.03, called d4cc4d_
  
• d4cc4d1 appears in SCOPe 2.07